PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_03033A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 250aa    MW: 26942.4 Da    PI: 10.2474
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_03033AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-163579147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               r +WT eE+e++++a  ++G + WktI + +g ++t+ q++s+ qky
  Oropetium_20150105_03033A 35 REKWTGEEHERFLHALLLFGRN-WKTIEQLVG-TKTATQIRSHAQKY 79
                               789*****************66.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-172984IPR009057Homeodomain-like
PROSITE profilePS5129418.0473084IPR017930Myb domain
SMARTSM007173.2E-103482IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.8E-163482IPR006447Myb domain, plants
PfamPF002497.4E-133579IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-83579IPR009057Homeodomain-like
CDDcd001671.41E-83780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MTAARNTNTT TGTQTPAAGK IVKKQRKPYT ISRPREKWTG EEHERFLHAL LLFGRNWKTI  60
EQLVGTKTAT QIRSHAQKYF LKVHKLGLAA ALPAPAHHPR RSAVLPRPLL SSQTAAGASV  120
NWMAASSRTT STAGAGAAAA AASWPGHHDD DPFTTTTPNS GGSRSDEASW LLADRLLQDD  180
DAAVQQQLPL SPDDLRFAEV YRFVGDVFGS GASRPVEAQL QRLHGADPVV AEMILLVLRN  240
LQDNLCLGV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638954.12e-66PREDICTED: protein REVEILLE 8
TrEMBLA0A0E0HA063e-67A0A0E0HA06_ORYNI; Uncharacterized protein
STRINGBGIOSGA018757-PA1e-65(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.27e-26MYB_related family protein